SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1140.Synpcc7942_0639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1140.Synpcc7942_0639
Domain Number 1 Region: 144-421
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2e-203
Family SCOPe 0.00000419
Further Details:      
 
Domain Number 2 Region: 9-141
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.65e-93
Family SCOPe 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1140.Synpcc7942_0639
Sequence length 430
Comment (Synechococcus elongatus PCC 7942)
Sequence
MPDDYGTQIAEITAREILDSRGRPTVEAEVHLEDGSVGLAQVPSGASTGTFEAHELRDDD
PSRYGGKGVQKAVENVSAIEDALIGLSALDQEGLDKAMIALDGTPNKKNLGANAILAVSL
ATAHAAATSLNLPLYRYLGGPLANVLPVPMMNVINGGAHADNNVDFQEFMIMPVGAPSFK
EALRWGAEVFHALAKVLKDKGLATGVGDEGGFAPNLGSNKEALELLLTAIEAAGYKPGEQ
VALAMDVASSEFYKNGLYTCDGVSHEPAGMIGILADLVSQYPIVSIEDGLQEDDWSNWKT
LTQQLGSTVQLVGDDLFVTNPDRLQSGIEQGVGNAVLIKLNQIGTLTETLRTIDLATRSG
YRSVISHRSGETEDTTIADLAVATRAGQIKTGSLSRSERIAKYNRLLRIEAALGENALYA
GAIGLGPKGR
Download sequence
Identical sequences Q31QJ8 Q5N3P4
4rop_A 1140.Synpcc7942_0639 269084.syc0886_c gi|81299450|ref|YP_399658.1| WP_011243198.1.45845 WP_011243198.1.5740 WP_011243198.1.95485 gi|56750895|ref|YP_171596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]