SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1140.Synpcc7942_2411 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1140.Synpcc7942_2411
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-24
Family BPHL domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1140.Synpcc7942_2411
Sequence length 94
Comment (Synechococcus elongatus PCC 7942)
Sequence
MIYCAYKGARDLLFFTTRRILLIDKQGITGKKQEYLSIPISRIQAFSYETAGTIDLDSEI
KIFISVLGALKIRIIRPTSNMDPAITALNMMLLS
Download sequence
Identical sequences Q31KH8
1140.Synpcc7942_2411 gi|81301220|ref|YP_401428.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]