SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 114615.BRADO3435 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  114615.BRADO3435
Domain Number 1 Region: 25-144
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-19
Family cAMP-binding domain 0.008
Further Details:      
 
Domain Number 2 Region: 147-223
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000113
Family CAP C-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 114615.BRADO3435
Sequence length 245
Comment (Bradyrhizobium ORS278)
Sequence
MSHLVRKLENFVRLSAADRLMLNRASAQRVRTFAPRTDIAREGEKPKDVHLILNGWACRY
KQLEDGRRQIVSFFLPGDICDLNIFILREMDHSIGTITSVSVADLSREFFDEISAGYPRV
ATAFWWETLVNAAIQREWTMNLGQRTASERMAHLLCELFFRLRLAGLADDHSCSFPLTQA
DLAEATGLSKVHVNRTLQELRASNLIVLKGKMLVLPDLDRLMSAGLFNANYLHLDREGRQ
LDANE
Download sequence
Identical sequences A4YTJ7
114615.BRADO3435 gi|146340402|ref|YP_001205450.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]