SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 114615.BRADO5606 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  114615.BRADO5606
Domain Number 1 Region: 447-557
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000608
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 114615.BRADO5606
Sequence length 584
Comment (Bradyrhizobium ORS278)
Sequence
MTEQPHDGSHHWAMLRSLQGWRISTLPADLTAGLTLAAIAIPEQMATAKLGGFAPETGFF
AFLAGSLGFALFGANRFLSCGADSTITPIFAGGLALLAASGTPEYGSIAAALALLVGVML
VLAGGFRLGGIANLLSVPVTVGFLSGIAVHIIVSQLPGVLGLPAPSGSTLARIAAMAGEL
GKTNIYTLIIGFGVLATVAVCERISACIPGALIALAAATIFVIGAGLEARGVPVIGAISG
GVPMPSVPLIAPEQWVKLVPLAFLIAVVVMMQTAATTRSFPSEPDRPADVDRDFLGAGAG
SVLAGLFGTFPVNASPPRTGIVVETGGRSQVAGLSAAVIVLLLVLFGARLLAHVPEAALG
GVLLFVALRIIRVTQIVQIYHASKGEFLLIVATAAAIVVLPIEQGVALGISLSLLHGIWS
TTRAHLMIFERVPDTTIWWPAHPHIRGEELSDIAVVGFQAPLSFLNAATFRADLQHLLQQ
RQPRLLVLEASAMVEIDFTAAQAMREVIRQCNEDGIVFAVARLESLRAQAAFERFGLYDV
LPRDHVFHSVDLALRSLRVEPLSGARETNGATPHSRHPRESGDP
Download sequence
Identical sequences A4YZF2
gi|146342447|ref|YP_001207495.1| 114615.BRADO5606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]