SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 114615.BRADO6217 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  114615.BRADO6217
Domain Number 1 Region: 96-295
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.09e-37
Family Phosphate binding protein-like 0.0021
Further Details:      
 
Domain Number 2 Region: 1-109
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-19
Family LysR-like transcriptional regulators 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 114615.BRADO6217
Sequence length 296
Comment (Bradyrhizobium ORS278)
Sequence
MRFDLVDLRLFIAVAEARSITGGADRAHLALASASARIKGLEETFGVALFKRGRRGVDLT
AAGESLLEHARIVMAHVETMQGDLSGFASGQRANVQLLANTVGLAEHLPKALAAFLRAHP
EINVDVEERESTEIAEAVASGRADLGFAAEHALPETIERFAFGEDRLVLVAGKRSGFAGR
RQIDFSETAGQDFIGLTQGTALNVHIGRHAARLGIRQHVRARLRDFDAICQMVAAGIGIA
VVPEAAARRCARTMPISLIPLRDAWADRRLVMCARSFKALPRPAKLLVEHLRGAAA
Download sequence
Identical sequences A4Z136
WP_012029748.1.46373 gi|146343029|ref|YP_001208077.1| 114615.BRADO6217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]