SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 114615.BRADO6247 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  114615.BRADO6247
Domain Number - Region: 106-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00209
Family NfeD domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 114615.BRADO6247
Sequence length 148
Comment (Bradyrhizobium ORS278)
Sequence
MSDMFVTLGTWNWLIFGVILMAMELLAPGVFLFWLGLAALLVGLLSFAVAPGWQLQILLF
ALFSIAAVPLWRRLARANAAASEDNPFLNRRSAALVGREFTLEKPIVNGNGTVRIDDTVW
RVAGPDIPAGSRVRIVQADGAQLTVTAA
Download sequence
Identical sequences A4Z163
114615.BRADO6247 WP_012029775.1.46373 gi|146343056|ref|YP_001208104.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]