SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1148.sll0493 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1148.sll0493
Domain Number 1 Region: 16-146
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.48e-28
Family Potassium channel NAD-binding domain 0.00065
Further Details:      
 
Domain Number 2 Region: 146-227
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 5.23e-17
Family TrkA C-terminal domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1148.sll0493
Sequence length 228
Comment (Synechocystis PCC6803)
Sequence
MKTSHFLSLIRQEKRQFAVIGLGRFGRAVCETLHVNGYEVLGIDQDPKLVAEVLADRVVG
NAISLDSTDDTALREAGIFEIETVIVAIGNYLKESIITCLNLKEGGVKSVVAKVSSDTHE
KILKRLGVDLIIFPEHKAGQDLAYTLTTPAIVDRFKLDPNNSIVEILVPEEFCDKTLAEL
QLRKNHGVSVLAVGHEEKFKINPPPQERLHRGMILVLLGSNEDIGRLV
Download sequence
Identical sequences A0SZ78 L8AQ94 Q55496
gi|383326959|ref|YP_005387813.1| gi|383323790|ref|YP_005384644.1| SgR143 gi|16332047|ref|NP_442775.1| gi|383492843|ref|YP_005410520.1| WP_010874070.1.11876 WP_010874070.1.1889 WP_010874070.1.18904 WP_010874070.1.33690 WP_010874070.1.35395 WP_010874070.1.47586 WP_010874070.1.99424 gi|16332047|ref|NP_442775.1| 1148.sll0493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]