SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1148.slr0935 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  1148.slr0935
Domain Number - Region: 93-136
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000131
Family NfeD domain-like 0.01
Further Details:      
 
Domain Number - Region: 11-77
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0157
Family Glycerol-3-phosphate transporter 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1148.slr0935
Sequence length 152
Comment (Synechocystis PCC6803)
Sequence
MSPVYLWIVAGTILCLVEVIFPVDFVAVVMGLSAVATAGVALLVPGSFALQSLFWLGLSV
LSIILLRRFLPRPSRKSILQDAVEGQCLTAILPGETGRVLYEGNSWRAECQDPDVAIAVN
EKVYVVGRSGNTLLVYPANALQGRSDIQHPNF
Download sequence
Identical sequences L8ATR2 P74300
WP_010873015.1.11876 WP_010873015.1.1889 WP_010873015.1.18904 WP_010873015.1.33690 WP_010873015.1.35395 WP_010873015.1.47586 WP_010873015.1.99424 gi|16330986|ref|NP_441714.1| gi|16330986|ref|NP_441714.1| gi|383325898|ref|YP_005386751.1| gi|383322729|ref|YP_005383582.1| gi|383491782|ref|YP_005409458.1| 1148.slr0935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]