SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1148.slr1856 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1148.slr1856
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.65e-26
Family Anti-sigma factor antagonist SpoIIaa 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1148.slr1856
Sequence length 109
Comment (Synechocystis PCC6803)
Sequence
MDIQINQQEDITVVTLSGEVDANTAPKIHEVILPLAEPGSKILLDMTAVPYMSSAGLRLL
LYLYRQTTANSAQLVLVGLSEELIDTMAVTGFLDFFTTRPTLAEGKEAF
Download sequence
Identical sequences L8AII6 P73607
1148.slr1856 gi|16330243|ref|NP_440971.1| WP_010872281.1.11876 WP_010872281.1.1889 WP_010872281.1.18904 WP_010872281.1.33690 WP_010872281.1.35395 WP_010872281.1.47586 WP_010872281.1.99424 gi|383321986|ref|YP_005382839.1| gi|383325155|ref|YP_005386008.1| gi|383491039|ref|YP_005408715.1| gi|16330243|ref|NP_440971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]