SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1148.slr1859 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1148.slr1859
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.73e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1148.slr1859
Sequence length 108
Comment (Synechocystis PCC6803)
Sequence
MAFNIESEIINNAAKLTLIGELDGGTAPLFKEKIEEVAQAEISKLVLMMDQLEYMSSAGL
RILVFAKQKMGSGVEIFLVGTQEMVNDTIEQTGLHHSFHLVESYDFHS
Download sequence
Identical sequences L8AIQ7 P73609
gi|383325157|ref|YP_005386010.1| 1148.slr1859 gi|383491041|ref|YP_005408717.1| gi|16330245|ref|NP_440973.1| gi|16330245|ref|NP_440973.1| gi|383321988|ref|YP_005382841.1| WP_010872283.1.11876 WP_010872283.1.1889 WP_010872283.1.18904 WP_010872283.1.33690 WP_010872283.1.35395 WP_010872283.1.47586 WP_010872283.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]