SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1148.ssr1600 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1148.ssr1600
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000961
Family Anti-sigma factor antagonist SpoIIaa 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1148.ssr1600
Sequence length 70
Comment (Synechocystis PCC6803)
Sequence
MVLDLSTIDFIDSSGLGALVQVTKLSQNKQGSVQIVTNPRVTQTVKLVRLEKFLHLHNSL
AEAIAATTEG
Download sequence
Identical sequences P74326
gi|383322755|ref|YP_005383608.1| gi|383325924|ref|YP_005386777.1| gi|383491808|ref|YP_005409484.1| 1148.ssr1600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]