SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 115713.CPn0909 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  115713.CPn0909
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.35e-25
Family Anti-sigma factor antagonist SpoIIaa 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 115713.CPn0909
Sequence length 110
Comment (Chlamydophila pneumoniae CWL029)
Sequence
MNLSAKEYGDIIVIYLQGSLDAVSVPSVQEYLEQFIQKKHLKIALNFTDVSYISSAGIRL
LLSNFKLVQSLGGKMCLCCVKESVTEVMRIAGLDQLILLCQSEQECLSKL
Download sequence
Identical sequences Q9Z6Z7
gi|384449921|ref|YP_005662523.1| 115711.CP0957 115713.CPn0909 gi|15618818|ref|NP_225104.1| gi|16752127|ref|NP_445494.1| NP_225104.1.662 WP_010883544.1.100378 WP_010883544.1.15326 WP_010883544.1.24544 WP_010883544.1.35099 WP_010883544.1.48548 WP_010883544.1.81029 WP_010883544.1.8178 WP_010883544.1.91433 WP_010883544.1.95540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]