SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002424251 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002424251
Domain Number 1 Region: 128-173
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000872
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 
Domain Number 2 Region: 235-264
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000506
Family Retrovirus zinc finger-like domains 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002424251
Sequence length 296
Comment (Pediculus humanus corporis)
Sequence
MNNFIFIDSEDSENSVVEVEVPKRATPPIIEINDDDIYLHLSNISERPKMMTNQIQDIQI
IKEIQKELPNNYDTQYCNPNHWTSDMIKFYNDDWGNEETFSVENIQRKMDKSPALWKISQ
KDLLRQHRSKRYYAYCDNCRQPGHVAYKCPEPLYVPKCHMCGTPGHIDHQCPNAICLNCG
NETGEFKLCCYKCKFQTNQVCSRCSLKGHNYINCPDHWRLFHLTTKTKNIIIPNLNVNKK
EKDIWCCNCGKKGHFFSNCHFPKELKSFTDSVPFIVSYKRDNALEKNNLQNGDKII
Download sequence
Identical sequences E0VDQ7
vb|PHUM123150-PA|EEB11513.1|conserved 121224.XP_002424251 XP_002424251.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]