SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002424468 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  121224.XP_002424468
Domain Number - Region: 111-137
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0112
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002424468
Sequence length 450
Comment (Pediculus humanus corporis)
Sequence
MSAQNIPVSEILRSKSNSDSLDIDDEPKKKSREDWRKAKELEEARKAGTAPAAVDEEGKD
INPHIPQYISSAPWYFGSKGPTLKHQRPQPEKRKEYSKLDEWYKRGTDKSKSYTKYRKGA
CENCGAMTHKKKDCMERPRKIGAKYSGVKIGYDEFIQPDLALDFDGKRDRWAGYDPSQHK
SIIEEYQKIEDAKHQLRAEKLNNADGMETEEAEGEGEDDEDKYVDDFDMPGTKVDSKQRI
TVRNLRIREDTAKYLRNLDPSSAYYDPKTRSMRDNPDVNNDTNAEDADYAGENFVRFTGD
TRKHAQAQKFAWDAYEKGVDVHLLAEPTKLEMLQKVYDKKKDEFKNDVQTNILGKDGGEE
HLKAPPKSLLLAQTEHYVEYSRYGKVIKGEEKPVIRSKYEEDVFPGNHSSVFGSYWKNGQ
WGYKCCHSFLKNSYCTGESGKVINNVPPIV
Download sequence
Identical sequences E0VEC4
vb|PHUM130720-PA|EEB11730.1|pre-mRNA-splicing 121224.XP_002424468 XP_002424468.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]