SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002425398 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  121224.XP_002425398
Domain Number - Region: 602-689
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00366
Family Anti-sigma factor antagonist SpoIIaa 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002425398
Sequence length 710
Comment (Pediculus humanus corporis)
Sequence
MDKRSESTVALTSYVPCSEDLEGGGNGGSIGPNGFTNVAAIDENDKTRHEKKNDNEINNS
TNNNSNEILINVNSLRWNKDVEYDGGQKNENHSSNVDNHLKVKLSDYNQSNNLPRLTSFE
KNSSPKKWLCKKVKKCCTKKLLYKRVPILSWLPQYSLNYAVADLVAGLTVGLTVIPQAIA
YANVAGLPPQYGLYSSFMACFIYAIFGSVKDSPIGPTAIAAILTRENLHGLGPEFAVLLC
FLSGCVELLMGILQLGFLIDFISGPVSAGFTSAAAIIIATSQVKDVLGLSFPGGNFLDVW
ENIFCNISNTRMGDAILGISCMIVLLVLRKIKDIPIGPRDVKEKTKMQKFLSQFLWLVST
SRNIVVVVVCGILAYAFHVEGEDGPFVLTGTVKGGLPSFHIPFYGAVDGNKTYSFSEVSS
NLGSAILVVPLLCILENISLAKVFAKGKSIDATQEMLAIGLCNIASSFVGSMPVTGALSR
GAVNNASGVQTTFGGIYTGIIVILSLQFFTPYFYYIPKSSLAAVIIAAVVFMVEFHVVKP
MWKTKKIDLIPAFATFLSCLFIRLELGIVIGISINVLFLLYASARPSVQVEKERTLSGIE
YLRITPDRSLVFPSVDYVRNVVTKAGVKQGSSYVPVVIDSKHIQGVDFTAAKGIKSLMDD
FVNRKQPILFYNLKPSIVDIFHSLRPKEFIYCTNENELNDFLKQHHVAGT
Download sequence
Identical sequences E0VH04
XP_002425398.1.24195 vb|PHUM196650-PA|EEB12660.1|Sulfate 121224.XP_002425398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]