SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002425959 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002425959
Domain Number 1 Region: 438-557
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000392
Family Anti-sigma factor antagonist SpoIIaa 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002425959
Sequence length 572
Comment (Pediculus humanus corporis)
Sequence
MDVMEIKTTTTGSSSLLQQNDRKMDLLNEETYRKLFYYDEPKKLPFIKKLKTTIKCDKQI
IFNIFPILKWLPKYKKTDLVSDIIAGLTVGVMHIPQGMAYALLGGVPPVVGIYTAFFPVL
MYIFMGTSHHVSMGTFAVVSMMVGKSVDEYAFVPETNSTIYYLEEPSKLTPIDVASALCL
VVGFWQLALSFFRLGSLSVLLSQTLVSGFTAGAAVHVLTSQIKNLLGIKAQRYSGSFQIL
YRYVDILSNLSTANVTSVILSLSFITLLVTFNEFVKPLMQKKLKKNIQFPIELLVVILGT
LLSMFLKLKENYGVVIVEYVPKGLPYPTVPHVNILPNLLTDGLIIAIVAVCINISMARMF
VQIKEVPGIFKTCKLEGLVWVSTFLSVIIFDISYGLGVGLIASAGSLLYKCKKFQIISLG
SIPNTKTYLDLNRYKKSQIVNNVIILRVVGGIHFANSNDVKTSLLKTYINMYKNMSLTFA
NEEKLKKNRPMVLDLSRVPFIDSSAIKCFKSLKQDLKIYKSDILLCGCNPGIYSTMEKSN
LFIDIPKSFIFHDLHDAFIHNFLESLLNRSID
Download sequence
Identical sequences E0VIL5
121224.XP_002425959 vb|PHUM228970-PA|EEB13221.1|sulfate XP_002425959.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]