SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002425971 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002425971
Domain Number 1 Region: 529-639
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000165
Family Anti-sigma factor antagonist SpoIIaa 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002425971
Sequence length 646
Comment (Pediculus humanus corporis)
Sequence
MQNEEETSSKDDDEELLLLTEEKFREKYNYEEMKKVTFKKKFKRNLKCNKEKILNFIPIC
RWLPKYNPKKDLGYDIIAGITTAVMHIPHGLSYAPLARVDPIIGLYMAIFPVFVYMIFGT
SRILSIGTFAVLCTMVGDVVNSHQANYQSLIDKAYATNNTLIVQHNYTSLEVGTAVCLLV
GFWQCLLGFLRLGVFMVVMSKSMVSGFTTGAAICVFSYQLKSIFGIHVQTFTGALKLVYF
YIDFFSKIKTTNCVTLGTSLSAIALLLFFNEYLKPLIKKKHPKNRIPVPIELFVLVIGIL
TSYMLDLKKNYNVEIVGYIPQGMPVAQMPPLSLLPHVITESFMVALVALSINLSLTKIFE
SKSDYVIDDNQELIAYGFSNIASSFFLCLPSAASLSRTTIQYSTGGKTQLASFFSAVLMI
LTIIFVQFLFEPVPYCILGSIVVVTLKGLLLQVLDLPKIIKENLMDGIIWIGTFFAVILI
DIDIGLGVGILLSVVSLAFSSSVLKVNVIGQVPQSNIYLNMEFYKSATSIPYILILKIEG
NVTFANCSNLEKKILREYKNFFAFSIEDDSNVILDLSSMNTIDPTGVKIFIELYQYFSKL
NTKLYITHCNNRVYRVLHKCKFFTIFPKEQVAASVNDVVIYLNSKK
Download sequence
Identical sequences E0VIM7
XP_002425971.1.24195 vb|PHUM229690-PA|EEB13233.1|Pendrin 121224.XP_002425971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]