SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002426207 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002426207
Domain Number 1 Region: 9-107
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.44e-26
Family Canonical RBD 0.0011
Further Details:      
 
Domain Number 2 Region: 104-126
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000046
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002426207
Sequence length 173
Comment (Pediculus humanus corporis)
Sequence
MSRYRDSGSDCKVYVGDLGSSASKQELEDAFGYYGPLRNVWVARNPPGFAFVEFEDPRDA
DDAVRGLDGRTVCGRRVRVEPSNGMGGRRRDRGPPPRRGRPFNPDDRCYECGERGHYARD
CNRHRSSRRRLLSSNKIHVFYLALNLGYSFNHSPKMEKFFIKLFIPPLYRGIG
Download sequence
Identical sequences E0VJB3
XP_002426207.1.24195 121224.XP_002426207 vb|PHUM241330-PA|EEB13469.1|transformer-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]