SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002426492 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  121224.XP_002426492
Domain Number - Region: 253-283
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00759
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002426492
Sequence length 869
Comment (Pediculus humanus corporis)
Sequence
MGVPAFFRWLSKKYPSVIVYCVEEKPKVIDGVKISVDSLQPNPNGVEFDNLYLDMNGIIH
PCTHPEDKPAPKNEDEMMIEIFDCIDRLFSIVRPRKLLYLAIDGVAPRAKMNQQRSRRFR
ASKESAEKIEEITRLREELLNKGAYLPPEKPQESHFDSNCITPGTPFMNRLSACLDYYIH
DKLNNDAAWKGIKVILSDASVPGEGEHKIMDFIRKQRAQPDHDPNTQHVLCGADADLIML
GLATHEPNFTIIREEFRPNKPKPCEICSQLGHDMKDCIGCPKPLDGEMIETTTFGEEVPF
IFVRLSVLREYLEKELTMPGLPFKYDFERVIDDWVFMCFFVGNDFLPHLPSLEIREGAID
RLVNLYKNCVYKTGGFVTDSGDVNLNRVQLILNELGKVEDEIFKHRQQTELMYKRRNAAK
KRIALQYKNEIPASLPVGQFAPTPLGQNFQPPAIVSPRQTARDMRIQASHSNSHIEALLK
DESSERRGNKRPLKEDSMEEEETYDEVRLWEDGFKDRYYESKFDVKSDNIDFRIRVAHEY
VRGLCWVLRYYYQGCASWKWFFPYHYAPFASDFINIGNLSTQFEKGTQPFKPLEQLMGVF
PPASSSHVPKSWAVLMHDPLSSIIDFYPLDFKIDLNGKKFAWQGVALLPFVDEKRLFRAL
APLYDLLTPAEKIRNTQGDDKIYLGINNKGYSFLKNLYESQESTPNEAIEICFDGMRGNV
LHSKDFIGHLETLLSPLRDLPSIHENVVISAHYRNPNYSSDFIFKAKRLKGVVEPQRVLK
PGDLSFEQNRQWRPQIGMVPSTKKAFVTDAGHRMLNHYNYESRNSGGYSSNRGGRVMSSY
NPHSSYNFQTPQSHVQAYGYSTVGSPRQS
Download sequence
Identical sequences E0VK48
121224.XP_002426492 vb|PHUM256920-PA|EEB13754.1|5'-3' XP_002426492.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]