SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002426878 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002426878
Domain Number 1 Region: 9-108
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.16e-26
Family Canonical RBD 0.00096
Further Details:      
 
Domain Number 2 Region: 104-125
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000963
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002426878
Sequence length 192
Comment (Pediculus humanus corporis)
Sequence
MSRYRDSGSDCKVYVGDLGSSASKQDLEDAFGYYGPLKNVWVARHPPGFAFVEFEDPRDA
DDAVRGLDGRSIAGRRVRVEPSNGMARRRGRDRGVSRRGRPFHPDDRCYQCGERGHYARD
CKRYRRGGRNRRSRSFTRSRSRDRRSRSRSNSKSRSRSKSRDKKSKSSDRRSKSNEKRTP
SKSSSKSRSRSR
Download sequence
Identical sequences E0VL84
vb|PHUM284060-PA|EEB14140.1|arginine/serine-rich 121224.XP_002426878 XP_002426878.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]