SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002427420 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002427420
Domain Number 1 Region: 4-39
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000205
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002427420
Sequence length 142
Comment (Pediculus humanus corporis)
Sequence
MFDDRKKELNVQNARCQKCLELGHWTYQCKGKRKTLHQISRTTLLKKRLKAYEEENQKKL
MQAEKQKTDVNSKSKPSKKDISAGDNNSDDSTESDSESDSDSSSSSSDSSSSSISSSSSS
SDSSSSSSSSSSESEDSSGDTK
Download sequence
Identical sequences E0VMS6
vb|PHUM318530-PA|EEB14682.1|conserved 121224.XP_002427420 XP_002427420.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]