SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002428219 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002428219
Domain Number 1 Region: 8-101
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.18e-30
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 2 Region: 98-125
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000192
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002428219
Sequence length 221
Comment (Pediculus humanus corporis)
Sequence
MSNEFKVTPSKSTVYVSNLSFSLTNNDLHKVFSEYGKVVKVTVMKDRKTRKSKGVAFVLF
LKKEDAQNCCKMLNGKEMFGRTLKASIASDNGRSAQFIRRRDYPDKSKCYECGEDGHLSY
KCPHNVLGERQPPPKKQRIRKKKNKNSSEPNIDFDSDNEVYEPDMETLSAAIALDHEEAE
KIKYEFKVATGQYETGVDKPETSKRKKFKQNGYFSDEEEID
Download sequence
Identical sequences E0VQ25
121224.XP_002428219 XP_002428219.1.24195 vb|PHUM370670-PA|EEB15481.1|RNA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]