SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002428698 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002428698
Domain Number 1 Region: 148-434
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.31e-67
Family Tandem AAA-ATPase domain 0.00067
Further Details:      
 
Domain Number 2 Region: 469-494
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000889
Family Retrovirus zinc finger-like domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002428698
Sequence length 513
Comment (Pediculus humanus corporis)
Sequence
MAEAKKESAMEKQLKEEEKILESVAEKKALMGVAELAKGIQYADPIKTSWTAPKCILALG
EKRHNRVRNKLRILVEGEDIPPPIKDFKGMKFPEPLLVALQKRGIMRPTPIQIQGLPTVI
WTRHDWHRVYRKRENISFRSSTHNVLPGTRSLIICPSRELAKQTHDIFQYYCKSLLESGF
PEIRCCLGIGGVPVSESLEVIARGLHILVATPGRLMDMLDKKLIRLDVCRYLCMDEADRM
IDMGFEEDVRTIFSFFKGQRQTLLFSATMPKKIQNFARSALVKPITINVGRAGAASMNVI
QEVEYVKQEAKVVYLLECLQKTAPPVLIFAEKKQDVDAIHEYLLLKGVEAVAIHGGKDQE
ERSRSVEAFRSGKKDVLVATDVASKGLDFPDVQHVINYDMPDDVENYVHRIGRTGRSEKT
GIATTFVNKANDESVLLDLKHLLMEANQKVPLFLANLKSENEKYLDLGDERGCSYCGGLG
HRITNCPKLEAVQSKAASNIGRRDYLANNSADY
Download sequence
Identical sequences E0VRF4
XP_002428698.1.24195 121224.XP_002428698 vb|PHUM397370-PA|EEB15960.1|predicted

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]