SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002429154 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002429154
Domain Number 1 Region: 84-125
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000014
Family Retrovirus zinc finger-like domains 0.0011
Further Details:      
 
Domain Number 2 Region: 35-83
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000000567
Family Retrovirus zinc finger-like domains 0.0018
Further Details:      
 
Domain Number 3 Region: 2-24
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000236
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002429154
Sequence length 131
Comment (Pediculus humanus corporis)
Sequence
MSTGLCYKCHQSGHFARLCPQGGGDRSSRGNRDGGNFGRGGGRDKCFKCNRYGHFARECI
EEKDRCYHCNAVGHIARDCPQPSSEPSCYNCNKTGHIARNCPEGSLKSCYSCGKTGHISR
HCDQPDDRNNR
Download sequence
Identical sequences E0VSR0
vb|PHUM422420-PA|EEB16416.1|cellular XP_002429154.1.24195 121224.XP_002429154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]