SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002429667 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002429667
Domain Number 1 Region: 101-220
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1e-26
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000269
Further Details:      
 
Domain Number 2 Region: 217-269
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000118
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002429667
Sequence length 317
Comment (Pediculus humanus corporis)
Sequence
MPTVLPTNLTKEQEEGYLLQLQIEEVSRKLRSGDLGIPPNPEDRSPSPEPIYSHDGKRLN
TREYRTRKALEEERHSLIIRMQSINPDFKPPADYKPPLVRVSDKVMIPQEDHPDINFVGL
LIGPRGNTLKTMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGEDEPLHAYVTANNPEAV
KKAVEKIKEVIRQGVEVPEGQNDLRRNQLRELALLNGTLREVDGPRCSNCGATDHKQWMC
PDKPNVTKSIVCSTCGGSGHIARDCRNKRPGGVAQTTGTESRKIDQEYMSLMAELGEVPP
QGRDGDNNKNNNNNNNR
Download sequence
Identical sequences E0VU73
vb|PHUM446410-PA|EEB16929.1|Splicing 121224.XP_002429667 XP_002429667.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]