SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002430145 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002430145
Domain Number 1 Region: 309-496
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.28e-47
Family cAMP-binding domain 0.00012
Further Details:      
 
Domain Number 2 Region: 69-304
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.45e-22
Family Voltage-gated potassium channels 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002430145
Sequence length 630
Comment (Pediculus humanus corporis)
Sequence
MMCSISTFAGRCLLPFCNSKTKDDGKTGDYYDKSKVFYKRNNFNESMKSGFPNGEHETNK
KQKNDRALDPQGKTYIIWLFVVTLAFLYNCWVIPLRSSFYYQTSENVNKWLAFDYACDVI
YLLDLLFFKPRVMYLSDGFWIKDSKLTRIMYFHKVQFKMDVLSLIPLDLLCLKYGTDYLP
IFRLPRFLKVQTFWEFYNRCDNVVASGYVVRVVRTLNYMLYLIHLNACAYYAFSVWEGLG
TNAWVFNGKGNAYIRCFYFATKTATSIGKNPKPENVFEYMFMTWSWLMGVFVFALLIGQI
RDIIATATRNRTEYKKLVDETLEYMRRLNLPMSLREKVKLWFKFTWEQQHTFNESNILDT
LPPKLKTDVAINVHIQALNKVQIFHDCDPALLRELVLKLQSVLFLPGDYICRKGEVGKEM
YIVKTGIVEVLGEDDNEVIATLKEGSVFGEISLLSLGAGNRRTASVRSGGFSNLFILNKY
DLNEALVYYPDAQEILKNKAKMKEKSLATQDIDERKKLIKENEERERQNRLKEQSEQSDD
VSDDTEDSSGSDDCKKESKKIEKIKNESKLNQLISTSAWLTTVTSVAIPEPILNKLSLNT
DDVIKKKITVKDSKDTIQCDVTVHNEMNCK
Download sequence
Identical sequences E0VVK1
vb|PHUM463940-PA|EEB17407.1|Cyclic 121224.XP_002430145 XP_002430145.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]