SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002431496 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002431496
Domain Number 1 Region: 108-152
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000712
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002431496
Sequence length 251
Comment (Pediculus humanus corporis)
Sequence
MGKGFNNYMCKKFFHPASRDNLKRVWMAEQKAEAYKKKQEELKMQYEKEQDLYTNKAMLS
KESNDKLSVNFLYEPPPGAKKEREREDNEPEYKFEWQRKYNAPRESYCKGDSEIRDQPFG
IQVRNVRCIKCHKWGHINTDRECPLFKEGVNHNLGLDPLNKPSDDKLNPLELVKQMQEDG
LHLKTSALALQHHVDMRGNRTMIPEPSLDEEILNRLTYSQKKLFLKTLKKMLKEKKKKKK
LAKKEKKSKRK
Download sequence
Identical sequences E0VZF2
vb|PHUM531020-PA|EEB18758.1|restnitis XP_002431496.1.24195 121224.XP_002431496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]