SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002431522 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002431522
Domain Number 1 Region: 26-125
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.12e-22
Family Canonical RBD 0.005
Further Details:      
 
Weak hits

Sequence:  121224.XP_002431522
Domain Number - Region: 122-140
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000174
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002431522
Sequence length 150
Comment (Pediculus humanus corporis)
Sequence
MSSRSRSSSASSKKSRSRSRSSKSSRSRSPSVDENCRLHVADLGQGVSKGELTRVFEKYG
PLKEVWVASSPPCFAFVVFENREDAEEAIQGVDNTSVGGNRVRVSVARPRTRGRGLKSYD
PNQRCYTCGERGHFSRDCNDTKYGYKRPSR
Download sequence
Identical sequences E0VZH8
121224.XP_002431522 XP_002431522.1.24195 vb|PHUM534180-PA|EEB18784.1|RNA-binding

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]