SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002431524 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002431524
Domain Number 1 Region: 263-333
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 4.53e-20
Family tRNA-intron endonuclease catalytic domain-like 0.002
Further Details:      
 
Weak hits

Sequence:  121224.XP_002431524
Domain Number - Region: 101-169
Classification Level Classification E-value
Superfamily TrmE connector domain 0.0589
Family TrmE connector domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002431524
Sequence length 334
Comment (Pediculus humanus corporis)
Sequence
MEFKKPKLKKQSLRIKEASSLIDKNQLIGVFNGLQIVITNQNLINCFPCYNLNKGDIPKI
ITEQQYQNESKWNTVNEITYRNSFFDDHCSSINSVNKFLLEAINDDINTQLQWQSWKANL
DNNLNKDFHKKRSCIIHNNVSRDNLLEFTEDSSIEVDEKFQKRINEIIDNKLIIQVKDYK
KSNEKVIVINILNDNLSPSLISIENFKARLMRRSYPMIESLLLNFEETLFLNYALNYFKV
HNENGVKLSIDELWEKFNKSQWNFFERYVIYHYYRTKGWIVKSGIKYGGDYLLYKEGPLY
SHASYLIKIFNPKQVFTWTKFLAINRLVETFNKV
Download sequence
Identical sequences E0VZI0
vb|PHUM534200-PA|EEB18786.1|tRNA-splicing 121224.XP_002431524 XP_002431524.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]