SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 121224.XP_002432339 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  121224.XP_002432339
Domain Number 1 Region: 554-892
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.47e-46
Family Tandem AAA-ATPase domain 0.00061
Further Details:      
 
Domain Number 2 Region: 434-454
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000106
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 121224.XP_002432339
Sequence length 1250
Comment (Pediculus humanus corporis)
Sequence
MRESYNKYFKIKTELLASQILNEENGNLNNLTQICDFNSTDNGKCDLNNESKKDNCQLNT
HDKNVNNSNESINKIDPKTWGENLNVPKENKKPKIEKCNSMSVLSQKLFKGSKFNKRNPR
KKPSFNKTLSTSSLQENSTLETTNLNSSSLSSNCAEENNDNKSDGICDSRESGLESISTS
SLSSSSMSISPLLTSSVLPSSGSLIERCSFIDGKTTPNVQKFNFLQDMTSRQLSTFQEDW
VERCTNFDDNIKPQRNSDSGFDSIASEEVKLNNEKSLFSDNNDDDDDDVICGSDNELNKE
DNNIISLSQKRKSQVLQDENSSQEKSHNDKMGNFSFHHLLNSATTHVTKKFKMDASSETT
LKSSSYNNEENAKMKILERKIQCGTLNDNYVKLNLEKKTYARGKKKFNFSKYKKQKWKKD
KKALNSERESGGILECFTCGEKGHFSRNCKKNKEDKLLDVDDEFENDCDVHLPTLEEARA
LAEEKGKQYQFNHKNIFNLQEPSEEIINFGKVEPLYELKENGDVIETPPEVYEALEKFGH
TYFRPGQEETIMRMLSGLSTLLIISTGGGKSLCYQLPAYLYAKRSKCITLVISPLVSLME
DQVSGSSCSFFKIGCLHTGLTDRQRENVLENTKNGKLHALLVSPEAIVSGDSSKGFGSIL
KQLPPIAFACIDEVHCISQWSHNFRPSYLMVNKVLREKFGIATVLGLTATATVSTIRSIT
RELKIESEKGVIKDIPIPDNILLSVSVDDDKDEALIKLLTSEKFQDFNSILIYCTRRDDC
ERLATYIRTVMQNFFDCNETHKKKNRKLSWTAESYHAGMAGPRRKQVQKAFMNGNVRIVV
ATVAFGMGINKKDIRSVIHYNMPRDFESYVQEVGRAGRDGMFAHCHLFLDPNGKDVNELK
RHINSNTIERHVLRKLLERVFVKCDCPNVKNQNGCTTHESGFDMKKTVQALDTPEENILT
LLCYLELDDRKFVKVLPPAYLNCKIKSYNGLNKIRTSAFKCPPLAYAFALDENQTKRKKC
NYLDFNVIDVSNGIGWKSSIVKSQLKNLEWETDDRGTWKKTGISVEFSDLGFRVLTRGDM
SPSELDESLECLVKRVENQEKRSTECLNLIYNVLEYYSHGNFEQVLNVGGVGGGAGTTTT
TTTIEKSKELKNEIRRYFETEKISEEIPLKNFQIEKFDEEIVANDVRTLLNTYRDNTFNA
RAVARIFHGIQSPNYLASTWYNCKYWRKHLDKDFNELLTIAKREILLWKL
Download sequence
Identical sequences E0W207
121224.XP_002432339 vb|PHUM580900-PA|EEB19601.1|ATP-dependent XP_002432339.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]