SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 122586.NMB1221 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  122586.NMB1221
Domain Number - Region: 77-132
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000106
Family NfeD domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 122586.NMB1221
Sequence length 135
Comment (Neisseria meningitidis MC58)
Sequence
MTVWFVAAVAVLIIELLTGTVYLLVVSAALAGSGIAYGLTGSTPAAVLTAALLSALGIWF
VHAKTAVRKVETDSYQDLDAGQYVEILRHTGGNRYEVFYRGTHWQAQNTGQEELEPGTRA
LIVRKEGNLLIITHP
Download sequence
Identical sequences A0A125WCY4 A0A2K7RJB5 C6S736 E6MWR3 I4E5J4 Q9JZA2
gi|385853145|ref|YP_005899659.1| gi|385338057|ref|YP_005891930.1| 122586.NMB1221 662598.NMO_1027 NP_274246.1.22327 WP_002222437.1.100741 WP_002222437.1.100975 WP_002222437.1.101004 WP_002222437.1.103 WP_002222437.1.15154 WP_002222437.1.15570 WP_002222437.1.1577 WP_002222437.1.15982 WP_002222437.1.16714 WP_002222437.1.17598 WP_002222437.1.1945 WP_002222437.1.21158 WP_002222437.1.21582 WP_002222437.1.22461 WP_002222437.1.22466 WP_002222437.1.24888 WP_002222437.1.25235 WP_002222437.1.25453 WP_002222437.1.2560 WP_002222437.1.25913 WP_002222437.1.26917 WP_002222437.1.27180 WP_002222437.1.28641 WP_002222437.1.28712 WP_002222437.1.30714 WP_002222437.1.31947 WP_002222437.1.3197 WP_002222437.1.34038 WP_002222437.1.34477 WP_002222437.1.3663 WP_002222437.1.3779 WP_002222437.1.38134 WP_002222437.1.38907 WP_002222437.1.39340 WP_002222437.1.41145 WP_002222437.1.4349 WP_002222437.1.4417 WP_002222437.1.46520 WP_002222437.1.47204 WP_002222437.1.48201 WP_002222437.1.49533 WP_002222437.1.50295 WP_002222437.1.50983 WP_002222437.1.52092 WP_002222437.1.56290 WP_002222437.1.5766 WP_002222437.1.59917 WP_002222437.1.60279 WP_002222437.1.60963 WP_002222437.1.61648 WP_002222437.1.6256 WP_002222437.1.63110 WP_002222437.1.63620 WP_002222437.1.63637 WP_002222437.1.64769 WP_002222437.1.65547 WP_002222437.1.66488 WP_002222437.1.66607 WP_002222437.1.67725 WP_002222437.1.68291 WP_002222437.1.69325 WP_002222437.1.70380 WP_002222437.1.70752 WP_002222437.1.74384 WP_002222437.1.74461 WP_002222437.1.75452 WP_002222437.1.76219 WP_002222437.1.78092 WP_002222437.1.78303 WP_002222437.1.78448 WP_002222437.1.79729 WP_002222437.1.80003 WP_002222437.1.80348 WP_002222437.1.81937 WP_002222437.1.82858 WP_002222437.1.83497 WP_002222437.1.84137 WP_002222437.1.84443 WP_002222437.1.85559 WP_002222437.1.87230 WP_002222437.1.87954 WP_002222437.1.89422 WP_002222437.1.89811 WP_002222437.1.90067 WP_002222437.1.9112 WP_002222437.1.91590 WP_002222437.1.91834 WP_002222437.1.9273 WP_002222437.1.93003 WP_002222437.1.95052 WP_002222437.1.96310 WP_002222437.1.97217 WP_002222437.1.97438 WP_002222437.1.9780 WP_002222437.1.97906 WP_002222437.1.98186 WP_002222437.1.99581 gi|15677094|ref|NP_274246.1| gi|254804998|ref|YP_003083219.1| GO.2823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]