SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 122587.NMA0489 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  122587.NMA0489
Domain Number 1 Region: 11-98
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000011
Family Anti-sigma factor antagonist SpoIIaa 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 122587.NMA0489
Sequence length 100
Comment (Neisseria meningitidis Z2491)
Sequence
MDFFLPNTMHTELNNGTLHISGDVTVKTLTAAAFTRFRQQCRLKDTRAVDLSGVGRADSA
CVSLLLEVLRGCKGSVRLTGIPESVRALSELYEIKDWLKS
Download sequence
Identical sequences A0A0U1RHF2 A9M0R8 C6S4W2 E0NBH6
gi|254804225|ref|YP_003082446.1| gi|218767467|ref|YP_002341979.1| 122587.NMA0489 374833.NMCC_0253 662598.NMO_0209 gi|161869248|ref|YP_001598415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]