SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 123214.PERMA_0105 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  123214.PERMA_0105
Domain Number 1 Region: 25-181
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.08e-28
Family Clp protease, ClpP subunit 0.066
Further Details:      
 
Domain Number 2 Region: 352-418
Classification Level Classification E-value
Superfamily NfeD domain-like 1.7e-17
Family NfeD domain-like 0.002
Further Details:      
 
Weak hits

Sequence:  123214.PERMA_0105
Domain Number - Region: 212-315
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00131
Family Glycerol-3-phosphate transporter 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 123214.PERMA_0105
Sequence length 422
Comment (Persephonella marina EX H1)
Sequence
MRYIIAFILFLFSLSPAGVVTGQWNAPVTPVMSDYVKRVIHKAEVEKADAVIIMIDTPGG
LDTSMREIIKTIMNSSVPVVVYVYPPGSRAASAGAIITVSADIAAMSPSTNIGSASPVQM
GGKDIEETMKKKIINDMVAFVKGIAKEKGRNEKIIVKMVTESINLTAEEALKKNVIDIIA
TDLDDLLNKIEGRTVKKHGKEIKISLKDKKIVKVEKSLKEKILTILTNPTVAYLLLMIGF
YGIFFELYNPGSLIPGILGTISLLLALYSLNIIDVNWLGVLLIAAGVLFFILEVITPTFG
ALALSGVIAILFGSLILTDPDSPYGDISLKIIIPVVAFSALFFLTVAYLGLKAQRRKTET
GMEGMIGMIGKAETDIDPEGKVFIAGEIWNAYSEEPIKKGENVKVVSVKGLRLKVERTEG
ET
Download sequence
Identical sequences C0QT88
WP_012676249.1.53201 gi|225849669|ref|YP_002729903.1| 123214.PERMA_0105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]