SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 123214.PERMA_1636 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  123214.PERMA_1636
Domain Number 1 Region: 138-423
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.95e-124
Family Enolase 0.00000000964
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.93e-56
Family Enolase N-terminal domain-like 0.00000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 123214.PERMA_1636
Sequence length 428
Comment (Persephonella marina EX H1)
Sequence
MSVIVDIRGREVLDSRGNPTVEAEVVLESGVVATALVPSGASTGETEAVELRDGDKNRFK
GKGVLKAVDNINTKIADLLIGENALDQVRIDRLMLELDGTENKSNLGANAILAVSLAVAR
AAAMELDIPLYRYLGGTNAKVLPVPLMNVINGGAHADNNLDFQEFMIVPVFGGRFKEALR
CGVEIFHTLKTVLKDKGYSTNVGDEGGFAPALNSTKEALDILMDAIKKAGYEPGEDVLLA
IDAASTEFYDKERKVYRFEGEELTADDMIVLYEEIEGTYPIISIEDGLAEDDIEGWKKLT
KALGDKIQLVGDDLFTTNPKLIKKGIEEGIANSVLVKLNQIGSLTETLDAIELAKVASYT
NVISHRSGETEDTFIADLAVATNAGQIKTGSASRTDRIAKYNQLLRIEEELGEDAVFKGK
EAYSKFIR
Download sequence
Identical sequences C0QRV6
123214.PERMA_1636 gi|225851168|ref|YP_002731402.1| WP_012675524.1.53201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]