SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 126740.TRQ2_0062 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  126740.TRQ2_0062
Domain Number 1 Region: 73-140
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000183
Family NfeD domain-like 0.0015
Further Details:      
 
Weak hits

Sequence:  126740.TRQ2_0062
Domain Number - Region: 23-75
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0275
Family Glycerol-3-phosphate transporter 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 126740.TRQ2_0062
Sequence length 140
Comment (Thermotoga RQ2)
Sequence
MEAWVFWLVLGVILMVAEILTPTFFIFWFGVGALAASLVSLYLGVYVQIIVFAAVSIVLV
FLTRRLVQNWESPRKIHVEEIAGKVALVIETIDNRKGTGLVKIDGDVWRAYAEDDDEVIE
KGEHVKIMKVEGAHVVVKRV
Download sequence
Identical sequences A0A0F6AJ28 A0A101ERE4 A0A117L9L0 D2C5D4 Q9WZW9 R4NZN1
gi|281411505|ref|YP_003345584.1| 126740.TRQ2_0062 243274.TM0865 590168.Tnap_0062 NP_228674.1.35502 WP_004080739.1.100023 WP_004080739.1.18251 WP_004080739.1.29620 WP_004080739.1.32102 WP_004080739.1.43545 WP_004080739.1.44660 WP_004080739.1.45724 WP_004080739.1.5118 WP_004080739.1.51363 WP_004080739.1.51822 WP_004080739.1.56403 WP_004080739.1.75526 WP_004080739.1.79805 gi|15643628|ref|NP_228674.1| gi|170287869|ref|YP_001738107.1| 282735 GO.2754 gi|15643628|ref|NP_228674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]