SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 126740.TRQ2_0930 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  126740.TRQ2_0930
Domain Number 1 Region: 7-189
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.15e-50
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 126740.TRQ2_0930
Sequence length 192
Comment (Thermotoga RQ2)
Sequence
MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIG
DEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKIC
VVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRA
LRRGYEEVKCSE
Download sequence
Identical sequences A0A0A6QKF9 A0A0F6AL78 A0A101EQY1 A0A101FA92 D2C706 G4FGT1 O05650
gi|15642790|ref|NP_227831.1| 281896 gi|281412077|ref|YP_003346156.1| gi|15642790|ref|NP_227831.1| 126740.TRQ2_0930 243274.TM0015 590168.Tnap_0646 NP_227831.1.35502 WP_004082456.1.18251 WP_004082456.1.1950 WP_004082456.1.29620 WP_004082456.1.32102 WP_004082456.1.44660 WP_004082456.1.45724 WP_004082456.1.5118 WP_004082456.1.51363 WP_004082456.1.51822 WP_004082456.1.56403 WP_004082456.1.75526 WP_004082456.1.79805 WP_004082456.1.89131 gi|170288726|ref|YP_001738964.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]