SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 126740.TRQ2_0939 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  126740.TRQ2_0939
Domain Number 1 Region: 123-344
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.88e-55
Family D-glucarate dehydratase-like 0.0000369
Further Details:      
 
Domain Number 2 Region: 3-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.38e-20
Family Enolase N-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 126740.TRQ2_0939
Sequence length 345
Comment (Thermotoga RQ2)
Sequence
MSRIVNVKLSLKRYEYEKPFHITGSVSSESRNVEVEIVLESGVKGYGEASPSFRVNGERV
EALLAIENAVREMITGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCY
LLGGKRDEIETDKTVGIDTVENRVKEAKKIFEEGFRVIKIKVGENLKEDIEAVEEIAKVT
RGAKYIVDANMGYTPKEAVEFARAVYQKGIDIAVYEQPVRREDIEGLKFVRFHSPFPVAA
DESARTKFDVMRLVKEEAVDYVNIKLMKSGISDALAIVKIAESSGLKLMIGCMGESSLGI
NQSVHFALGTGAFEFHDLDSHLMLKEEVFRGKFIQDGPRMRVKDQ
Download sequence
Identical sequences A0A0F6AL87 D2C6Z7
gi|281412068|ref|YP_003346147.1| 126740.TRQ2_0939 590168.Tnap_0637 WP_012310829.1.18251 WP_012310829.1.32102 WP_012310829.1.44660 WP_012310829.1.5118 WP_012310829.1.51822 WP_012310829.1.75526 gi|170288735|ref|YP_001738973.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]