SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN00181 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN00181
Domain Number 1 Region: 187-225
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000126
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN00181
Sequence length 482
Comment (Caenorhabditis brenneri)
Sequence
MKKQRQERSGADNCNAFVALTYYFKDERAPNPWPQVPKQSGGAFGSLGRSSAQPKKFGGG
FGSSVSSSTGFGGSLIGRSSGGGGGGVEPDPDTIFNLLPSSFKQRKETAGFNVSRGGFGV
GGGFGAAVSPSSRLLTSEPSSLMDIKSDDRCATPKSTENVVAGNISASRRGGFGNSPRTS
EVMSPSKRSRTGRRTGRRGPRGPGHCFHCQEHGHISRECPKKATETDDIDESGGAEGTET
DRFVYQVAVNESPTQPPTPSAQSTLPSLTTRDAHLNAKLENQKQRESYYAGYGYGKTTTS
TAATGGSGIGSLMNSSSNTGFESGGRSSGAIVGVVAVSGGGCGVAAGAGGGSIKSPEVDK
FSEQLDNALKLHHVAESTPTQSPRGLTQMGKGGGGGESSRITSNKHQQHHETMPTKSDSL
PGRDPIKDISSEMLTIETRRIVMREGECHLEETTIINFPRLLPPNVRVITAQFVPVTSPQ
GV
Download sequence
Identical sequences G0NWZ0
CBN00181 135651.CBN00181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]