SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN00280 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN00280
Domain Number 1 Region: 159-261
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.61e-26
Family Canonical RBD 0.00053
Further Details:      
 
Weak hits

Sequence:  135651.CBN00280
Domain Number - Region: 116-143
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00314
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN00280
Sequence length 262
Comment (Caenorhabditis brenneri)
Sequence
MAGINSITTAPEVVSWAEAVEQDNSPHVQEGADGIRTETAFTEVDGVRYKVVTQFKVINK
RVPKVVADRKKWVKFGACKGEPAGPQVATTYVAEEVEMQFTRNRAGEQILDVQEDKQTAK
ATSREHCRHCKGNDHWSTHCPYKVMYQLDEENDANNDPQQDRNAMGLRGDGRQIDRNRSD
ENTCRVTNLPQEMNEDELRDVFGKIGRVIRIFIARDKITALPKGFAFVTFESRDDAARAI
AELNDIRMYHMVLKVEWTRPSN
Download sequence
Identical sequences G0N412
135651.CBN00280 CBN00280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]