SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN00630 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN00630
Domain Number - Region: 94-135
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00259
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 
Domain Number - Region: 15-64
Classification Level Classification E-value
Superfamily DNA-binding protein Tfx 0.0915
Family DNA-binding protein Tfx 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN00630
Sequence length 372
Comment (Caenorhabditis brenneri)
Sequence
MASYKQNLPLSALLRKQVSAANKKSKAEVQRDRQLEEDRKAGTAPALVDVQTGRDINPHI
PMFISQNPWYVPSKGPTLEHQRPHEKRQKNMTQIHDWHQKGTTRKAATKFRKGACENCGA
MSHKKRDCFGRPRKANAKETNTNIAEDEYVQPKLTLGFDAKRDRWDGYDPATHKQVIEDY
ELLVRARKVFKEHEMKKGKAEHVLAEDGAPKDEDMYAEDADMAGVSVDMDSRTRITVRNL
RIREDPAKYLLNLAENSPYYDPKSRSMREDPFAGVAGKELEAARFSGDNFVRYSGEVTAA
NEAQVFAWQATRGGVYAHSIGEPTKLEALKKEYEKGKSTLKNETQKELLDKYGGVEHVER
PADELLLAQTES
Download sequence
Identical sequences G0NGZ0
CBN00630 135651.CBN00630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]