SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN01052 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN01052
Domain Number - Region: 75-114
Classification Level Classification E-value
Superfamily beta-lactamase-inhibitor protein, BLIP 0.0405
Family beta-lactamase-inhibitor protein, BLIP 0.014
Further Details:      
 
Domain Number - Region: 130-193
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0785
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN01052
Sequence length 259
Comment (Caenorhabditis brenneri)
Sequence
MIDEDEKPVFKKQWKYKSTQVLRDLMKMLSKSTDPVQTAKLARRITVNFTDHLHLGYSKC
CVPCKEEFEETKEMELELAMRRSYELLDDPPPSIQPLEYEKIKTGKTEKQVLDLLQSEQL
ELMYFYADQVLPLKRMSKRLLSAWRWLKFLCVFSIYFSLIICTAVFAFRYYSYGEFNDRF
YMITTPFTTFYFCARAYGASAQASNFRFSQKKRETLENHRRDLVFSSWLTALSVERYIYR
TGGNLKFEESILSKITNLR
Download sequence
Identical sequences G0NZ31
CBN01052 135651.CBN01052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]