SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN01889 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN01889
Domain Number 1 Region: 3-83
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000954
Family Canonical RBD 0.0094
Further Details:      
 
Weak hits

Sequence:  135651.CBN01889
Domain Number - Region: 78-103
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0445
Family Retrovirus zinc finger-like domains 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN01889
Sequence length 302
Comment (Caenorhabditis brenneri)
Sequence
MPSKLFVGNLPDNVDSNKLKQIFQPFCKVTECDIVKNYAFVHIEEDDVDSIITRLTGYTI
EGKVVNIKKSTSKLRPTPGMPNRCFRCQSDEHRTPQCPQDPANHQKADGFQTIKIDLTSG
SLKRSAADSLMDMPKRAAYGVQAVVEPEIPQPMDPDLQNLYGEYQLSRQRYLYYRDRLLK
EMEAKQHGSTVGFALSSNSSIPVPVASVPPGATQLSAAPVSYQPSAPPAIPSINSPYTSN
LRAPYAAPSAPYAAALQPSAPYGTVTPAGQPSGVMTTQQYLQQMHQQHSGSPAPVPAPSR
LY
Download sequence
Identical sequences G0MPA4
CBN01889 135651.CBN01889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]