SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN01908 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN01908
Domain Number 1 Region: 1084-1524
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.33e-146
Family Reverse transcriptase 0.00000947
Further Details:      
 
Domain Number 2 Region: 1601-1737
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.94e-28
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 
Domain Number 3 Region: 743-790
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000144
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 
Weak hits

Sequence:  135651.CBN01908
Domain Number - Region: 831-928
Classification Level Classification E-value
Superfamily Acid proteases 0.000823
Family Retroviral protease (retropepsin) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN01908
Sequence length 2052
Comment (Caenorhabditis brenneri)
Sequence
MDGLGDVGGSAEERQLLEDELLRDVVETDAAIRDDGRSSSMEVDVLERETMQNQLVREDE
MNRIFGETAAAINLQTTFSKKQISECFLKDMREFTDQMHTLLCQKEFDILEAQNRETKIL
KENCDLQLHLSQILSTSDQAQQPPRLDYLAQFTEENQKILIEMVQYMNRNGVDSIEEMND
FCQKTSEKRRCELQKAQQEVAKFKADNLALRHEKALLKSHLAAVESQRDDWKRKEGELRR
KIEWNTYSRPGRLTAVAGSSTPKIDIQTLARELHQETPPQPRPRSSYGKQQTKENNTEKE
AARFYNANTQEILDDDDIPVEETLEQFLREIRKNAQEKAGYVPTRNDSVNLEYRVLYCNN
SFRLIDGSRMGVTHLKLIFCRWQENHIRRLRHNTHSGSSYGKQHMKENNTEKEAARFYNA
NTQEILDDDDIPVEETLDQETHSHYHERRTTEHSDQFAQNVRDAKLAKSLPNPPKFTADE
NSISIEEFEEMFKMKYQFYTDKQQVLYLGTTLLGGKALKAFRGLAEKDKKSAASVLHAIK
IRLCLSSDDESRRAIDKFEKLTVKKGESVEDFCLRMDDVSRVAHQGMGEGAKSMQKLTKL
LNNLHFVDEGRAIEIAVDSAIRNVSREEQYDVARETVTRLERQRQDRQKEMSRWENEKRN
TKFFNKNTNLTTQKTASNGENAAAQPDNLIQANSNQRGQNQGTPIPSQVANQYQFQNSQN
MQANQKQSFVDRTQGNWRDRQKPNELSQKCTDCNQMGPHDPRCPKAPKRYLPTCYACKEV
GHYANECPVNKPQQARHQAINLSLFPLPLPQKQIPQYPYVPVDFPIISLAEVNIMLDSGA
CISLIGKDLWEEIVSKNGVEWGNKAKEECTEFIKVYAANNEPIKLHFQVKAETSLHSRTR
DITYYVADVDRDTIILGIDHFDKLGIKMSIESEARDIRMAKTVTLYPGAKLFAEVKVGGM
IDAAKNHCLVNPTVPWLSPSVCQVTTTGKGVIQVANYTKQTVVLEKGQKIATGELDGFQV
IQEKAECMQILEEHFGHHEDTKDLNELICSITGSADCNEHWKVLCEHLKKESVGTKEEEE
VWGIVRKFQHIFAVDDNELGRTNAVECEIELVEGAEPVRQKPRPIPLAIRPEIRKMIQKM
LAQGVIRESHSPWASPVVLVKKKDGSVRMCIDYRKVNKVVRYNAHPLPNIEATLQSLSGK
KVFTTLDLLAGYWQIPLKEQSKEITAFAIGSELFEWNVLPFGLVTSPAIFQATMESVIGD
MLGICAFVYVDDLLIASESLEQHAKDLERVLERVEKSGMRFRASKCHIAQEQVAYLGHKI
TPEGVRTEEAKIDKMKKFPRPTNPKEVQSFLGLVGYYRKFVINFAQMASALTPLTAKQAV
WRWEEEQEAAFQSLIQAICSTPVLMQPNTEAAIDGSKPFLIYTDASRKGVGAVLAQQGDD
GEQHPIAFASKALTPAETRYHITDLEALGMIFALRRFKTIVYGTQILVYTDHKPLIYLLR
GTPLADRLLRWSIELLEYNVKIIFVNGKANNVADALSRGGCEEAHEGVLAGHFGVKKMYR
QLSKKFYWPKMRASIESFVRSCQKCLCTNDSPKLVAPLNPYITSRPLEIVACDLVDIGVS
TSGNRYMLTIIDLFTKYGTAIPIPDKRGETVLKAFVDRWAVGEGRIPETLLTDQGKEFVN
EHFQNLAKILNIKHITTKGYNSRANGGVERFNKTITHIIKKKNRVSYEWDEQVRLMCCRC
ERKCTFVYRWPTGVPKTQTQELRSSSPTHLAGMVRLLEMNPDLSSDVVYGLSGKDVPSLS
ELPMDSLWPIFGQCPSFHIWLEEIKGWSKEYSYYHSRMIQKHLGNDLLRKAGTVVLLLPS
VRQKEVMIGGSEVVSLEAESWRETMEMLCKRNLQHIIMVIPFFHEAESQDEFKQIINVVP
ATTKLTLVPGYFAQLDYAKVPEFCRLYGRLLREQGTVESVLPEDRVSTAQNQTLINLTGS
VKLYWERVQTIVKERSMQWPTDLTSTQTSSPVPHQQEQPRTSVTTGPMRTPHQKLTPAPY
PREFQRTTYRRQ
Download sequence
Identical sequences G0MYJ9
CBN01908 135651.CBN01908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]