SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN03348 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN03348
Domain Number - Region: 110-144
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00293
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN03348
Sequence length 421
Comment (Caenorhabditis brenneri)
Sequence
MGKGFQNFMSKKDFHPSAFRNLKMVWEARQKKSLEDKRQEELRVAYEKEQEILNNKALLG
DEKAKMGLSFMYDAPAGMTKREEPKEEPKFEWQRKYQAPREDWAKGNEDIQDQPFGIQVR
NVRCCKCHKWGHINTDRECPLFGKSGNFEDEGYANNPSDLIKDLRKQRQAGTSSKPTSSK
STGDDDEEWMDHQQLASDMREEHGIVLKGSVLSGMQTDQQLARMKNDETSDMLNFINSLS
EKEQKKLQKMLISGGDMEDFMLKKYKKDKKKAKKEEKKAKKREIKQEEPSSEESEPEENP
RRRSPSPVRRRRHDSGSPDVRRNGNGRERSRSPFQRRRSPSPVRRRRDSRSPQRKSRRHD
SGSPDVRRNGNRSRSPFQRRRSPSPARRRHDSRSPDVRRNGNKRHDSREYRRKEERGSRR
S
Download sequence
Identical sequences G0ND16
CBN03348 135651.CBN03348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]