SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN04179 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN04179
Domain Number 1 Region: 745-845
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000045
Family Retroviral protease (retropepsin) 0.033
Further Details:      
 
Domain Number 2 Region: 667-693
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000541
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN04179
Sequence length 966
Comment (Caenorhabditis brenneri)
Sequence
MSDRDNVVDSVEGTGHGRSVTQTVQGKATLTGAFGLPSATSTSTPSLSSTMPSSQSTEDV
TATGKPHEPKGDVTGNSENQIVQLGGASTTDKRHKLYGSTLEQDLQIVHREPGNENGVLV
GTELNTASTLSSQKFVIATTSHKEGLDTQDSSKISEFFTPFVVASAQSTPRETQSFPWIH
EEHHHNRELSQNQQTSNYEMKSTSTTIDKDIVNRLLKKEDKSIGTGDTAKPDIKYGKQNC
VQSANGEGGHDNQPSQFGSQLLDNFSPTPASKLTAQETNKTVQPGDQQSTKRAEGQDEQN
RSIKSVSTKVSETNQLEDQDKINTKDLGTIKTKDQEKIKRKDLETIKQTDQDRIQPVKET
NSFELLNTGGEASKANVNLAGIFTVNSSTDQTNQSNEEAEDQRSSKGSTGSTTPSDTHVE
DTTKEQLYDHLTAATTVIDSRKATGSAANSSTRTSNPITIKSIPQVMVVTYVAKLNKFSG
TATDVTFSKWLERYRRFVLVTEGESTGKVALATFLMHLEGRALDRAEHIKAATPDIDLEE
LIEKLKEVFESDTHRYAAEQKLNKIKQDAAERVEDYADKLLELAHRAYKDINVPSTQETL
LTKFKYGLLPSLGMHVTVKNPTTIFEAINVAVKLQGLNDMTKEEEAAEIKATVCNVEKRL
DKDEAKEAKRNRFSDKKCYHCGEEGHIRRHCFLKHGKEEVIRRRRKDKDGPAPSKPINNQ
QKGAAVKAVSSKQDEEESDFLVTQIPIRANGYSTAALIDTGASITLAGSQLCKTLGISVL
EQHGSGGAMCLGNNTVTIMGAAPVTFIIGSGKYTHRVHFIDGACAPGSRNSYDFIIGNDL
LKKMPTLSVDFKKSIVRFGRESIPLGSKKTTAKAPRPAICQIAVKKHTCTQPEQQSQPAS
AVTTEEAPADVYLKKSKVKKDKRHKPAGKAGAVAPATRKLITRRNPEKSTGTSPTLMKGG
AATPLQ
Download sequence
Identical sequences G0NQE6
CBN04179 135651.CBN04179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]