SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN04532 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN04532
Domain Number 1 Region: 267-551
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.09e-64
Family Tandem AAA-ATPase domain 0.00019
Further Details:      
 
Domain Number 2 Region: 583-616
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000314
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN04532
Sequence length 631
Comment (Caenorhabditis brenneri)
Sequence
MSTDDVEAARKKYEERRRKIQEEEMKERRDGMNLSSGEEDEDVDDMFLTALQRKREKVHR
RALLKQVLAPTMNQKEEIERKRRKKEEEKRSEEAAKTLLEKHAEIMETQGVIDESERQLR
EEEELLDKVTRGGGLLAVTELVKGEKYEEPIVTAWRPPGHIRRQTQADYENQRKRLGISC
EGDSIPPPIGSFLEMKFPKELLEFLQKQKGIVTPTAIQIQGIPVALSGRDMIGIASTGSG
KTMTFVLPLIMFCLEQEMKLHFTRNEGPFGLIIVPSRELARQIYDLIIEMSEAIAKVGLP
ELRAGLCIGGVPIGEQAKEFRLGIHIVVATPGRLSDMLTKKIINLEICRYLVLDEADRML
DMGFEDEIKSIFYFFKAQRQTLLFSATMPKKIQFFAKSALVKPIIVNVGRAGAASLNVLQ
ELEFVRSENKLVRVLECLQKTSPKVLIFAEKKVDVDNIYEYLLVKGVEVASIHGGKDQSD
RHAGIEAFRKNEKDVLVATDVASKGLDFQGIEHVINFDMPEDIENYVHRIGRTGRSGKRG
LATTFINKKSEMSVLSDLKQLLVEAGQELPEFLRSLAGEEEGTAPAGTHADKGCAYCSGL
GHRITDCPKLAGIGNKTTQALARGGGDDGGF
Download sequence
Identical sequences G0P097
135651.CBN04532 CBN04532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]