SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 135651.CBN05579 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN05579
Domain Number 1 Region: 91-242
Classification Level Classification E-value
Superfamily L domain-like 2.61e-25
Family L domain 0.01
Further Details:      
 
Weak hits

Sequence:  135651.CBN05579
Domain Number - Region: 58-97
Classification Level Classification E-value
Superfamily L domain-like 0.0964
Family L domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN05579
Sequence length 261
Comment (Caenorhabditis brenneri)
Sequence
MTRWGHVDQLTGCRHLVELAQRLPRLASSTRYDCRLPRLGLQSKISTRTPDFMVLTISFI
KPVTVNLEQLHPDFCLTIQELVVFLNAAAYFRHLHAKLCDFNQSDFEVEVCRFENLSVLK
PDCVYIVGDLNINNGDEELVQKLEKVEIIFGSLVIQNTLLKNLDFFGNLRKIANFNETAP
IIKIVNNENLRKIELPKMDGSISKGYSVAIIEGTEVFESTQSCMIFQFHTRTNVSYNGGN
CSEFLEQKEFHFDYRAFRIIQ
Download sequence
Identical sequences G0P861
135651.CBN05579 CBN05579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]