SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN06211 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  135651.CBN06211
Domain Number - Region: 45-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0128
Family Anti-sigma factor antagonist SpoIIaa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN06211
Sequence length 133
Comment (Caenorhabditis brenneri)
Sequence
MAHSISLLSLLTCVDPQKEKAMGDSMDMSTLMDEVNSIISSLPESDLRRQAADLIAEGEQ
IMRAIGEVDASANGELMKLKEEVQQNDAKLMVFAYCEKVLKILSEHGKILSRRFDEISRS
TYYGPSSTVNPPK
Download sequence
Identical sequences G0MHP9
135651.CBN06211 CBN06211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]