SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN07157 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN07157
Domain Number 1 Region: 282-444
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.69e-48
Family G proteins 0.00000122
Further Details:      
 
Domain Number 2 Region: 176-268
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.88e-23
Family Canonical RBD 0.0012
Further Details:      
 
Weak hits

Sequence:  135651.CBN07157
Domain Number - Region: 134-160
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00628
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN07157
Sequence length 452
Comment (Caenorhabditis brenneri)
Sequence
MAGINSITTAPEVVSWAEAVEQDNSPHVQEGADGIRTETAFTEVDGVRYKVGIAEKLAAN
SNFPNFQVVTQFKVINKRVPKVVADRKKWVKFGACKGEPAGPQVATTYVAEEVEMQFTRN
RAGEQILDVQEDKQTAKATSREHCRHCKGNDHWSTHCPYKVMYQLDEENDANNDPQQDRN
AMGLRGDGRQIDRNRSDENTCRVTNLPQEMNEDELRDVFGKIGRVIRIFIARDKITALPK
GFAFVTFESRDDAARAIAELNDIRMYHMMGFLKILRKQRAREREMRILILGLDNAGKTTL
MKKFLDEPTDTIEPTLGFDIKTVTFKGFQLNLWDVGGQKSLRSYWKNYFESTDALIWVVD
SSDRERLTQCSEELKKLLGEERLAGASLLVLANKSDLPGAIDVNSIAQVLDLQSIKSHHW
KIFSCCALSGDRLIQAMTWLCDDVGSRIFILD
Download sequence
Identical sequences G0PH28
CBN07157 135651.CBN07157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]