SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 135651.CBN07680 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  135651.CBN07680
Domain Number 1 Region: 665-692
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000138
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 
Weak hits

Sequence:  135651.CBN07680
Domain Number - Region: 731-762
Classification Level Classification E-value
Superfamily Acid proteases 0.00797
Family Retroviral protease (retropepsin) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 135651.CBN07680
Sequence length 809
Comment (Caenorhabditis brenneri)
Sequence
MEDEELDRLLNRTNPNLPSASRCQNLFGTQSPNPADNIANMVTSPTDQPMHPTLLDPNQL
DDDLLRDHEMEEPVDEWSRQQLEQVRQQEDDEVIEKTMTAIKLETKLPDSRVAKLLSGLK
KLLNKKEILIQEKEFDVRRCRKQQIVDENEIRILQLRAERAREMAEDRAEDSSQKSSIRM
EADATMRRMLEEESQKTAILKNRIRQMEGQLNDHHLLRLKCEHLSAQNEEFKQELKFQKA
NYESNTYARKGQNFSRNEHNNDMAFQTTERSCTSAISMHPPELRSLSSKYPSHTQNKEYR
EQARKYNESTEEILDETEFQQNETYSPRKNQSVNHTQRHSFIQSSDSHIDKAEQRRLESL
LPEPPKFSADEKSVEIETFERAFLMKYGSLLPEHQVMLLESKHLVGKALQVCKGLPITEK
HSVQSILTAIRNRLRMSESDESRRAKSRWESLSRRENQSVEDFCLLLDEIAQKAFKGCPD
NQVSSMKTNKLLFDLRDEENLMCTIDAELRKTPEEDQYDMCRILATRHELQVKERQLYRT
QNRNVNGEKKVDRQVANNRNSPYQAAGNNESQYPQYQATVPRRNGFPRDPSTVETPILSQ
QTTQGSQKMGPASGTAVQNWRGAGVTPSGNDNTGGGAGYRCSEWLQTGCHDPNCSKAPGA
AKARPNIPGSCFYCKEQGHFANACPKKSGNQSTTQQNTEQNTRVAQSISKGCLSVPSKEE
NVEGEETPIKILKGRIGNADVDIMLDSGACISLISAKTWKQIVSKNGIEFEKNAIIPDYK
PIEVFAANNQKIDLLFHAIRNSRKSGWKE
Download sequence
Identical sequences G0PAV5
CBN07680 135651.CBN07680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]